PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG025205t1
Common NameTCM_025205
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 162aa    MW: 18627.1 Da    PI: 8.2425
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG025205t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-202879556
                      SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++++++q+++Le++F+++ +p++++r+eL+k+lgL+ +q+k+WFqN+R++ k
  Thecc1EG025205t1 28 HRHSTHQIQTLEAFFKECAHPDENQRRELSKELGLEPKQIKFWFQNKRTQTK 79
                      5789********************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-20975IPR009057Homeodomain-like
SuperFamilySSF466895.43E-191181IPR009057Homeodomain-like
PROSITE profilePS5007116.0822181IPR001356Homeobox domain
SMARTSM003892.8E-162385IPR001356Homeobox domain
CDDcd000869.29E-162579No hitNo description
PfamPF000468.5E-182879IPR001356Homeobox domain
PRINTSPR000312.4E-55261IPR000047Helix-turn-helix motif
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PRINTSPR000312.4E-56177IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MDIARGNIGS SDDEHKASTC HEKGRIYHRH STHQIQTLEA FFKECAHPDE NQRRELSKEL  60
GLEPKQIKFW FQNKRTQTKA RKERAENSIL RASKESLLYE NTAMREALAK MVCVCCGSPL  120
LPEPQAGHGL HQLELENTQL KQGLEKLTKF LANYINMHDH Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007029327.11e-119Homeodomain GLABROUS 8, putative
SwissprotQ69T582e-44ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A061F5M81e-119A0A061F5M8_THECC; Homeodomain GLABROUS 8, putative
STRINGVIT_04s0079g00480.t011e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.12e-41homeodomain GLABROUS 8
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]